PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004488419.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Dof
Protein Properties Length: 277aa    MW: 30765.6 Da    PI: 8.6727
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004488419.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.92.2e-383089362
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    ++alkcprCds ntkfCyynny+lsqPryfCk+CrryWtkGG lrnvP+Ggg+rk+k s+
  XP_004488419.1 30 HHALKCPRCDSFNTKFCYYNNYNLSQPRYFCKNCRRYWTKGGVLRNVPIGGGSRKSKPSN 89
                    6789****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-233081IPR003851Zinc finger, Dof-type
PfamPF027013.8E-333286IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9843387IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MQEIHSIGGR NLFGDDRDRR MRTNYHHQNH HALKCPRCDS FNTKFCYYNN YNLSQPRYFC  60
KNCRRYWTKG GVLRNVPIGG GSRKSKPSNS NNSSSSTTPP ATTRKSPPPE DNSNSHSSSE  120
SSTFTTPTAT AEAKTPISNA TSKVFSVNSA SKPEQVGSFT SLVPSTLTND AFSFGFGNNV  180
LDASSFRFGD SHQRGDDQVH VAQGGDSLGI CQWQQQSSYQ RTSLLDHQQL ANGFGPLDWQ  240
GGAGNCLFDV RDVVDQSYWT HPHWSHHVNP SSLFHLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0878517e-47AB087851.1 Pisum sativum PsDof6 mRNA for DNA binding with one finger 6 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004488419.10.0PREDICTED: dof zinc finger protein DOF5.4-like
TrEMBLQ76KU86e-87Q76KU8_PEA; DNA binding with one finger 6 protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.12e-32OBF binding protein 4